BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30466 (562 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 3.1 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 7.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 7.2 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 338 RCLRPKNCHSFLFANVKRRFLNCSKTTNVIGVLNISLSSI 457 R RP NC L+A + + C K L+ SL + Sbjct: 712 RLARPANCSPDLYAVMLNCWKECPKNRPTFTELSKSLEGL 751 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 7.2 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -2 Query: 360 QFLGRRHRSSRRLVGKCDGVHAPPSAKLCRSTRLAEFRRR 241 Q G+R RS+ R + H P S + R E R+R Sbjct: 6 QEFGKRGRSTGRGLKYSGQQHGPQSDSRNQQLRTGEKRKR 45 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = -1 Query: 97 PSVGRVSGSWRHLRCRFPW 41 P G+V G HL+ W Sbjct: 320 PGCGKVYGKTSHLKAHLRW 338 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,789 Number of Sequences: 336 Number of extensions: 2496 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -