BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30466 (562 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical prote... 24 3.9 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 23 6.8 AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 23 9.0 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 9.0 >AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical protein protein. Length = 195 Score = 23.8 bits (49), Expect = 3.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 51 LQRKCRQLPDTRPTDGVVIQKSTGQLTLR 137 L+RK RQ D T+G VI + G+ T+R Sbjct: 105 LERKLRQAADEGSTNGTVI--TIGEHTIR 131 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 300 HAPPSAKLCRSTRLAEFRRR 241 H PPS L + T LAE +++ Sbjct: 289 HLPPSTALVQQTNLAEQQQK 308 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 22.6 bits (46), Expect = 9.0 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -2 Query: 492 TSSSDIVGANKVIELREILSTPITFVVLEQFRNLLLT 382 T + A+ +IEL++I +PI + + N + T Sbjct: 333 TEKTSTCSADDIIELQDIRMSPIASLRNRHYSNTITT 369 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.6 bits (46), Expect = 9.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 245 RRNSANLVLRQSLADGGAWTPSHLPTSLLEERCL 346 RR + + QSL D G + S T+ ++RCL Sbjct: 550 RRGRSTISAIQSLVDAGKASRSFGQTNNRDKRCL 583 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 543,027 Number of Sequences: 2352 Number of extensions: 10225 Number of successful extensions: 66 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -