BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30466 (562 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-3259|AAG22448.2| 300|Drosophila melanogaster CG18810-P... 28 9.9 AE014134-1066|AAF52356.2| 808|Drosophila melanogaster CG31640-P... 28 9.9 >AE014134-3259|AAG22448.2| 300|Drosophila melanogaster CG18810-PA protein. Length = 300 Score = 27.9 bits (59), Expect = 9.9 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 2/87 (2%) Frame = -2 Query: 360 QFLGRRHRSSRRLVGKCDGVHAPPSAKLCRSTRLAEFRR--RCHLSGIVLNFV*LTN**P 187 Q + +H KC G+ APP ++ CR + R C +G + Sbjct: 86 QLVRGQHSEDWHECDKC-GILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGH-------E 137 Query: 186 SPTYIFHILIYDVPQSNVKLTGQLIFV 106 + Y F+ LIY + LT IF+ Sbjct: 138 NYRYFFYFLIYFFLSCMISLTSSSIFI 164 >AE014134-1066|AAF52356.2| 808|Drosophila melanogaster CG31640-PA protein. Length = 808 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 224 IPERWQRRRNSANLVLRQSLADGGAWTPSHLPTSLLEE 337 +P N + +L ++ DGGAW P H+ ++ L+E Sbjct: 1 MPNPHHHASNWFSRLLLKTDNDGGAWCPKHMVSNALKE 38 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,730,957 Number of Sequences: 53049 Number of extensions: 464353 Number of successful extensions: 963 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 963 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2172596895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -