BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30466 (562 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g30340.1 68416.m03831 nodulin MtN21 family protein similar to... 29 2.8 At1g79410.1 68414.m09254 transporter-related low similarity to o... 27 6.5 At3g22040.1 68416.m02780 receptor-like protein kinase-related co... 27 8.6 >At3g30340.1 68416.m03831 nodulin MtN21 family protein similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula] Length = 364 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = +2 Query: 410 KTTNVIGVLNISLSSITLLAPTMSDDDVNNVVSLTYK 520 K ++ ++NI LS + ++ M D+ +N +V+ TY+ Sbjct: 10 KAVLMMSMINIGLSVVNVMFKKMIDEGLNRMVATTYR 46 >At1g79410.1 68414.m09254 transporter-related low similarity to organic anion transporter 3 [Rattus norvegicus] GI:5545293; contains Pfam profile PF00083: major facilitator superfamily protein Length = 515 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 248 RNSANLVLRQSLADGGAWTP 307 RNSA ++LRQ+L GGA P Sbjct: 437 RNSATMMLRQALVVGGACCP 456 >At3g22040.1 68416.m02780 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function that is usually associated with protein kinase domain Pfam:PF00069; similar to receptor-like protein kinase 5 (GI:13506747){Arabidopsis thaliana} Length = 257 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 336 SSRRLVGKCDGVHAPPSAKLCRSTRLAEFRRRC 238 +S ++ +C G + + C T LA FR+RC Sbjct: 83 NSTTIIFQCRGDSYKSNCRTCYDTALAGFRKRC 115 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,402,284 Number of Sequences: 28952 Number of extensions: 223933 Number of successful extensions: 541 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -