BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30462 (747 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces po... 28 1.6 SPBC3H7.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 26 6.6 >SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 793 Score = 27.9 bits (59), Expect = 1.6 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 429 FGNMYYLFNIRTCRTRVLFYV*INLCEIH 515 FGN+Y+L ++ R L+YV ++ EI+ Sbjct: 432 FGNVYFLATLKDSTERHLYYVSLDTLEIY 460 >SPBC3H7.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 287 Score = 25.8 bits (54), Expect = 6.6 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +1 Query: 148 F*CLRTARRY*HRANRDHACA*NLPQNVSKMFKLKLYFIC 267 F CL + R H+ R+H + LP N++ F + +C Sbjct: 173 FSCLNHSPRQIHKTVRNHLFSPPLPSNLALSFSISNASVC 212 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,050,147 Number of Sequences: 5004 Number of extensions: 62708 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -