BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30461 (867 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 24 5.2 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 9.1 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 24.2 bits (50), Expect = 5.2 Identities = 12/51 (23%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +2 Query: 203 SLPVYYHPLYIVDDYEIKEFTVADYKNGIVNRFQCSN---TGIHISYQYYA 346 S+ YYHP+ + + ++++F G+++ F ++ G HI+ +A Sbjct: 114 SVTTYYHPILMGGEGKLEDFKKVQDAVGVLDSFLSASRWTAGDHITVADFA 164 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 9.1 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 383 LINNPSNKPRALKISTPRVSDWP-TAVKQTIKLHQGIDTKEY 505 L++ P P + S+P WP AV+ T+ H G+ E+ Sbjct: 1204 LLHPPGTAPNSFHKSSPGRGSWPGPAVENTLG-HNGLLDAEH 1244 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 852,371 Number of Sequences: 2352 Number of extensions: 17698 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92613024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -