BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30461 (867 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 1.6 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 22 8.4 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 8.4 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 8.4 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 8.4 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 8.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 8.4 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.2 bits (50), Expect = 1.6 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 570 HTTATAITFSLSGTGIIPVTTSYSLVS 490 +TTAT T S G+G +P + + S VS Sbjct: 225 YTTATMATTSTPGSGSLPASPADSGVS 251 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 244 LRNQRIYCCGLQKWNSKQISVFKYWHSYFLSIL 342 L R YC KW +++ VFK S +S L Sbjct: 467 LLQDREYCPRYIKWTNRERGVFKLVDSKAVSRL 499 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 21.8 bits (44), Expect = 8.4 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 Query: 397 WIVYQYFLHKQ*WYRP 350 W+VY K+ W RP Sbjct: 35 WVVYNNIKRKRSWSRP 50 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 678 LHNQPS*PVCCIEWL*K 628 LH QP CC WL K Sbjct: 391 LHMQPRKKNCCRSWLSK 407 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 678 LHNQPS*PVCCIEWL*K 628 LH QP CC WL K Sbjct: 391 LHMQPRKKNCCRSWLSK 407 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 8.4 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 Query: 397 WIVYQYFLHKQ*WYRP 350 W+VY K+ W RP Sbjct: 156 WVVYNNIKRKRSWSRP 171 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 8.4 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -3 Query: 607 LDPTLDYITHFSAHNSYGNNILTFRYWYHSCHN 509 LDP L + F+ + N +TF Y S N Sbjct: 596 LDPNLPKLALFATKDIKQNEEITFDYMCQSSKN 628 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.8 bits (44), Expect = 8.4 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -2 Query: 245 NHLQCTMGDNTQVK 204 NH+ +GDN ++K Sbjct: 318 NHISARVGDNVEIK 331 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 226,216 Number of Sequences: 438 Number of extensions: 5319 Number of successful extensions: 20 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28038087 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -