BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30459 (728 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 29 0.68 SPBC1711.17 |prp16|SPBC17G9.01|ATP-dependent RNA helicase Prp16|... 28 1.2 SPBC25H2.08c |mrs2||magnesium ion transporter Mrs2|Schizosacchar... 26 4.8 SPAC3H1.08c |||DUF1640 family protein|Schizosaccharomyces pombe|... 26 4.8 SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosacchar... 26 6.3 SPAC19A8.15 |trp2||tryptophan synthase|Schizosaccharomyces pombe... 25 8.4 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 25 8.4 SPAC21E11.05c |cyp8||cyclophilin family peptidyl-prolyl cis-tran... 25 8.4 >SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1096 Score = 29.1 bits (62), Expect = 0.68 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -3 Query: 690 SNCFANESTTGSESRPAEKIRRETQRADAWVRLHVDLF 577 S+C +ES ES PA K E D+W+ ++F Sbjct: 299 SSCLLDESMVTGESVPARKFPLEDNSLDSWMIASCNIF 336 >SPBC1711.17 |prp16|SPBC17G9.01|ATP-dependent RNA helicase Prp16|Schizosaccharomyces pombe|chr 2|||Manual Length = 1173 Score = 28.3 bits (60), Expect = 1.2 Identities = 16/64 (25%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +3 Query: 306 HDDLGLESIRKYMK-SASERYFDKAMRHDNRLIVAAADYSPNPDHAGASHRRRPRHVLTD 482 H+ +E +K++ AS+R+ + +M NR+I + +P + + R H+L D Sbjct: 318 HEAEFIEKQKKHLSIEASDRFKENSMWEKNRMITSGVSKAPGLESDYSLMEERRVHLLVD 377 Query: 483 PSDP 494 P Sbjct: 378 ELRP 381 >SPBC25H2.08c |mrs2||magnesium ion transporter Mrs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 422 Score = 26.2 bits (55), Expect = 4.8 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -1 Query: 698 NSRAIVSRMNLLPDRNRDPLRKSGEKLSGLMHGLG 594 N R+ N++ D NR+ L G KLS + GLG Sbjct: 312 NIRSTEEICNIMLDANRNSLMLLGLKLSAMTLGLG 346 >SPAC3H1.08c |||DUF1640 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 211 Score = 26.2 bits (55), Expect = 4.8 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 330 IRKYMKSASERYFDKAMRHDNRLI 401 IRKY+++ E FDK + ++LI Sbjct: 98 IRKYLETIEENEFDKVRKSSDKLI 121 >SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1191 Score = 25.8 bits (54), Expect = 6.3 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 406 PPLTTPRILIMQEPVTVDALDTSLRIHQIQ*PLH*MP 516 PP+ +PR +PV V+A+ S + Q PLH P Sbjct: 270 PPIPSPR---PPQPVAVEAIQQSRAVISQQLPLHVSP 303 >SPAC19A8.15 |trp2||tryptophan synthase|Schizosaccharomyces pombe|chr 1|||Manual Length = 697 Score = 25.4 bits (53), Expect = 8.4 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 105 PMICKRSKMSLRNKVTLYK 161 P ICK ++++L+N +TL K Sbjct: 63 PTICKGNEIALKNNITLEK 81 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 25.4 bits (53), Expect = 8.4 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 508 NAKVIGSDGSVRTCLGRRR 452 N++ +GS GS T LGRRR Sbjct: 3 NSRSVGSTGSNNTPLGRRR 21 >SPAC21E11.05c |cyp8||cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp8|Schizosaccharomyces pombe|chr 1|||Manual Length = 516 Score = 25.4 bits (53), Expect = 8.4 Identities = 11/45 (24%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +3 Query: 294 NVDLHDDLGLESIRKYMKSASERYFDKAMRHDN--RLIVAAADYS 422 N++LH D ++ +++ A + Y+ + H N R ++ D S Sbjct: 288 NIELHTDYAPHAVYNFVQLAKQGYYRNTIFHRNIARFMIQGGDPS 332 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,738,749 Number of Sequences: 5004 Number of extensions: 51699 Number of successful extensions: 144 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -