BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30458 (782 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 24 1.8 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 24 1.8 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 24 1.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.2 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 7.4 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.8 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 502 VSPLNLPKKD-SLGLAWMSPLLTWVPANEK 588 V P N+ KD S+ L W+S + W N K Sbjct: 172 VVPGNMGLKDQSMALRWVSENIEWFGGNPK 201 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 23.8 bits (49), Expect = 1.8 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 502 VSPLNLPKKD-SLGLAWMSPLLTWVPANEK 588 V P N+ KD S+ L W+S + W N K Sbjct: 43 VVPGNMGLKDQSMALRWVSENIEWFGGNPK 72 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.8 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 502 VSPLNLPKKD-SLGLAWMSPLLTWVPANEK 588 V P N+ KD S+ L W+S + W N K Sbjct: 172 VVPGNMGLKDQSMALRWVSENIEWFGGNPK 201 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 83 EVLPHGRIFFPPSLSSCRRQ 142 +VLP+G + FPP + RQ Sbjct: 53 QVLPNGNLVFPPFRAEDYRQ 72 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 7.4 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +3 Query: 264 DSGDYEMILGY-RAQ---HSTHRTPTKGGIRFSTDVTRDEV 374 ++ DY M +G RA+ HS+ + G+ F VTRD V Sbjct: 417 ENTDYFMPIGRPRAKDYGHSSGSVIDRNGVMFFNMVTRDSV 457 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 228,219 Number of Sequences: 438 Number of extensions: 4815 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -