BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30454 (754 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28830.1 68417.m04121 expressed protein 89 4e-18 At4g29510.1 68417.m04210 protein arginine N-methyltransferase, p... 31 0.62 At2g19670.1 68415.m02299 protein arginine N-methyltransferase, p... 31 0.62 At3g12270.1 68416.m01532 protein arginine N-methyltransferase fa... 31 0.82 At3g20020.1 68416.m02533 protein arginine N-methyltransferase fa... 30 1.4 At4g33100.1 68417.m04716 expressed protein contains Pfam PF05254... 29 2.5 At5g04980.1 68418.m00527 endonuclease/exonuclease/phosphatase fa... 28 7.7 At2g40370.1 68415.m04978 laccase, putative / diphenol oxidase, p... 28 7.7 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 28 7.7 >At4g28830.1 68417.m04121 expressed protein Length = 208 Score = 88.6 bits (210), Expect = 4e-18 Identities = 42/82 (51%), Positives = 54/82 (65%) Frame = +1 Query: 508 MKLKTLEGHLQDLKGFSKPKIKFEQYETPAHIAAIALYTIQTQFGDLEDKLILDAGCGPG 687 MKLK LEG L DL+ FS PK++FEQY T HIA+ L+T + +GD+ DK++ D GCG G Sbjct: 1 MKLKQLEGLLGDLEQFSNPKVEFEQYPTGPHIASRMLFTAENSYGDITDKVVADFGCGCG 60 Query: 688 NLSIGAVLLGAGFVTSVEIDAD 753 LS A LL A V +ID + Sbjct: 61 TLSAAAALLDAASVIGFDIDPE 82 >At4g29510.1 68417.m04210 protein arginine N-methyltransferase, putative similar to protein arginine N-methyltransferase 1-variant 2 [Homo sapiens] GI:7453575 Length = 390 Score = 31.5 bits (68), Expect = 0.62 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 646 LEDKLILDAGCGPGNLSIGAVLLGAGFVTSVE 741 ++DK++LD G G G LS+ GA V +VE Sbjct: 106 IKDKIVLDVGAGTGILSLFCAKAGAAHVYAVE 137 >At2g19670.1 68415.m02299 protein arginine N-methyltransferase, putative similar to protein arginine N-methyltransferase 1-variant 1 [Homo sapiens] GI:7453577 Length = 366 Score = 31.5 bits (68), Expect = 0.62 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 646 LEDKLILDAGCGPGNLSIGAVLLGAGFVTSVE 741 ++DK++LD G G G LS+ GA V +VE Sbjct: 82 IKDKIVLDVGAGTGILSLFCAKAGAAHVYAVE 113 >At3g12270.1 68416.m01532 protein arginine N-methyltransferase family protein similar to protein arginine N-methyltransferase 3 from {Rattus norvegicus} SP|O70467, {Homo sapiens} SP|O60678 Length = 590 Score = 31.1 bits (67), Expect = 0.82 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 646 LEDKLILDAGCGPGNLSIGAVLLGAGFVTSVE 741 L +++D GCG G LS+ A GA V +VE Sbjct: 275 LNGSVVMDVGCGTGILSLFAAKAGASRVVAVE 306 >At3g20020.1 68416.m02533 protein arginine N-methyltransferase family protein similar to SP|Q96LA8 Protein arginine N-methyltransferase 6 (EC 2.1.1.-) {Homo sapiens} Length = 435 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 646 LEDKLILDAGCGPGNLSIGAVLLGAGFVTSVE 741 +E K+++D GCG G LSI GA V +V+ Sbjct: 117 IEGKVVVDVGCGTGILSIFCAQAGAKRVYAVD 148 >At4g33100.1 68417.m04716 expressed protein contains Pfam PF05254: Uncharacterised protein family (UPF0203) Length = 92 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -1 Query: 442 GILRYKITTRCCVGVLECSSMTSIYHICFRKLRKTSCCRNWWD 314 G+L+ K +T C+ + + YH CF K + WD Sbjct: 2 GLLKKKDSTSARSSTSPCADLRNAYHNCFNKWYSEKFVKGQWD 44 >At5g04980.1 68418.m00527 endonuclease/exonuclease/phosphatase family protein contains similarity to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 437 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 606 CNCSVHNSNTIWRFGR*TYFRC 671 CNCS + + + ++GR + FRC Sbjct: 125 CNCSTFSEDIVRKYGRESCFRC 146 >At2g40370.1 68415.m04978 laccase, putative / diphenol oxidase, putative similar to laccase [Populus balsamifera subsp. trichocarpa][GI:3805960] Length = 580 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 371 NTSHRAALQHANATSCGYFVSQDSSFGNQILPVLP 475 NT+ A LQ+ +A CG + GN P++P Sbjct: 300 NTTTTAILQYKSAPCCGVGGGSGTKKGNSFKPIMP 334 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 245 GAVAPLTAALSQPNPVSQLPMCSIPPVSATAGFPQLPE 358 G + PL+ + QP P++++P PP A P+ PE Sbjct: 629 GQLPPLSMGMMQPPPMAEMPP-PPPPGEAPPPLPEEPE 665 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,334,391 Number of Sequences: 28952 Number of extensions: 344609 Number of successful extensions: 1007 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1006 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -