BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30453 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC24C6.10c |||conserved eukaryotic protein|Schizosaccharomyces... 27 3.1 SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subuni... 25 9.5 SPAP7G5.04c |lys1||aminoadipate-semialdehyde dehydrogenase |Schi... 25 9.5 SPAC227.01c ||SPAPB21F2.04c|Erd1 homolog|Schizosaccharomyces pom... 25 9.5 >SPBC24C6.10c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 374 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 388 IYVLEYTCDSSIIYDCFFFVSK 453 +Y L+ SI YDCFFF+ + Sbjct: 70 LYQLDENAVLSIFYDCFFFLKE 91 >SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subunit a Pol2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 2199 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 356 LLLFEF*DLNVYMYWNILV 412 L LF F DLNV YW+ L+ Sbjct: 1858 LPLFHFLDLNVTEYWDYLL 1876 >SPAP7G5.04c |lys1||aminoadipate-semialdehyde dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1419 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 532 KDYKKVIMDIKDLKKSPAVRYVIDNVI 452 K Y+K+I DI++ K+ Y I +VI Sbjct: 813 KKYRKLIHDIREYLKTKLPSYAIPSVI 839 >SPAC227.01c ||SPAPB21F2.04c|Erd1 homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 373 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +2 Query: 377 DLNVYMYWNILVIRVLFMIVFFLLANDIINYI 472 DLN ++ + LV+R+ F++VF L + +I ++ Sbjct: 6 DLNHFINYFPLVLRLFFLVVFGLYSFTLILHL 37 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,428,872 Number of Sequences: 5004 Number of extensions: 46961 Number of successful extensions: 85 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -