BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30453 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z67879-3|CAA91789.2| 278|Caenorhabditis elegans Hypothetical pr... 29 3.8 AL132876-3|CAD21657.2| 746|Caenorhabditis elegans Hypothetical ... 28 6.6 U28971-5|AAA68379.1| 982|Caenorhabditis elegans Hypothetical pr... 27 8.7 >Z67879-3|CAA91789.2| 278|Caenorhabditis elegans Hypothetical protein C05E7.4 protein. Length = 278 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 483 GLFFKSFMSIITFL*SFDCFY 545 GLFF+ IT L +FDCFY Sbjct: 108 GLFFQMLSVYITVLAAFDCFY 128 >AL132876-3|CAD21657.2| 746|Caenorhabditis elegans Hypothetical protein Y105E8A.3 protein. Length = 746 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -2 Query: 265 VCIIFWALSNSNYKVYNFMIHKASPI*VSKFIFKNYFSFNSICDVH 128 V ++ WALS+S+ + + A + ++ F+F F SIC H Sbjct: 245 VAVLSWALSSSSGASIGYFHYAALLVIIAVFVFVLDFYAESICFQH 290 >U28971-5|AAA68379.1| 982|Caenorhabditis elegans Hypothetical protein B0244.6 protein. Length = 982 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = +1 Query: 538 VFIGMGNYFDHIAAFIILSF*CVLMELFVYYYKY 639 ++ GN FD I FII++ C++ + + ++ + Sbjct: 416 LYFSFGNLFDFIGNFIIIASVCLVFTIAILFFVF 449 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,257,563 Number of Sequences: 27780 Number of extensions: 257832 Number of successful extensions: 653 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -