BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30449 (782 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O57747 Cluster: Putative uncharacterized protein PH0032... 36 1.5 UniRef50_Q99665 Cluster: Interleukin-12 receptor beta-2 chain pr... 33 6.1 >UniRef50_O57747 Cluster: Putative uncharacterized protein PH0032; n=1; Pyrococcus horikoshii|Rep: Putative uncharacterized protein PH0032 - Pyrococcus horikoshii Length = 370 Score = 35.5 bits (78), Expect = 1.5 Identities = 20/66 (30%), Positives = 37/66 (56%) Frame = +3 Query: 495 LFACTYVAVNDMLIYNIIIKPATSASGGCFETLL*MFIVLFTRLLKS*RIRFCFQSLRFL 674 LFA A+ L++ + P+ S G F+ LL + + +FT L S ++ F+ +FL Sbjct: 169 LFASVPAALVSKLMFPMRFWPSFEYSYGLFDYLLILLLGIFTGLYSSAFMQLLFKLRKFL 228 Query: 675 IKKNHK 692 +K+++K Sbjct: 229 VKRSYK 234 >UniRef50_Q99665 Cluster: Interleukin-12 receptor beta-2 chain precursor; n=17; Eutheria|Rep: Interleukin-12 receptor beta-2 chain precursor - Homo sapiens (Human) Length = 862 Score = 33.5 bits (73), Expect = 6.1 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -1 Query: 275 GVSLSNRETITWCVFIRASTTTRRGDINIRTTHLLLYCSLTIPTTCDVLP 126 G SL+ ITW + +RGD+ ++ +H++L S T+ TC + P Sbjct: 7 GCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGS-TVNITCSLKP 55 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,944,986 Number of Sequences: 1657284 Number of extensions: 14897407 Number of successful extensions: 34596 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 33351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34586 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 66262109095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -