BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30449 (782 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68216-4|CAA92463.2| 565|Caenorhabditis elegans Hypothetical pr... 29 5.0 Z70038-1|CAA93884.1| 2219|Caenorhabditis elegans Hypothetical pr... 28 6.6 Z30317-5|CAA82971.4| 1890|Caenorhabditis elegans Hypothetical pr... 28 6.6 >Z68216-4|CAA92463.2| 565|Caenorhabditis elegans Hypothetical protein F27C8.5 protein. Length = 565 Score = 28.7 bits (61), Expect = 5.0 Identities = 18/82 (21%), Positives = 35/82 (42%) Frame = +1 Query: 205 LRVVVDALIKTHHVIVSLLLSDTPEVGGGRAISSACSSHSRQNKDPLSRSAVIRRKPRSL 384 LR V + + +S L + GR ++ + S HS + DP+ + + +P + Sbjct: 414 LRPAVGGKVSSSRGALSNLSNSEQNKKYGRGVTQSFSGHSLNDNDPMPKEHDPKVQPSVI 473 Query: 385 DAAGRLPCVEYVSILPINMENI 450 + LP VS++ M + Sbjct: 474 ISCLSLPTTSPVSVVKPKMTGV 495 >Z70038-1|CAA93884.1| 2219|Caenorhabditis elegans Hypothetical protein ZK1067.2 protein. Length = 2219 Score = 28.3 bits (60), Expect = 6.6 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 171 KKMCCPDIDIPSTCSSRCSDKNAPCNSFSVAK 266 + MC ++ TCS++C + PC +F K Sbjct: 1787 QNMCQKVLNCGHTCSAKCGESCPPCKAFCTNK 1818 >Z30317-5|CAA82971.4| 1890|Caenorhabditis elegans Hypothetical protein T16G12.1 protein. Length = 1890 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -1 Query: 284 PTSGVSLSNRETITWCVFIRASTTTRRGDINIRTTHLLLYC 162 PT ++LSN I ++ TTT+ N +T+LL C Sbjct: 1171 PTDMIALSNEVDIQRTIYDNGWTTTKFATTNQMSTYLLALC 1211 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,358,407 Number of Sequences: 27780 Number of extensions: 366153 Number of successful extensions: 877 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 877 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1893203640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -