BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30444 (680 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H1.10 |||phytochelatin synthetase |Schizosaccharomyces pomb... 27 3.3 SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 26 5.8 SPAC1B3.02c |||transcription elongation factor, Elf1 family|Schi... 25 7.7 SPAC977.10 |sod2||CPA1 sodium ion/proton antiporter |Schizosacch... 25 7.7 >SPAC3H1.10 |||phytochelatin synthetase |Schizosaccharomyces pombe|chr 1|||Manual Length = 414 Score = 26.6 bits (56), Expect = 3.3 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +3 Query: 324 LISE*NNQTDECPGSFSRLRHSVRSVRDFEILFVKTNYNISY 449 LI E +N + G F + +RS + + + TN N+ Y Sbjct: 304 LIQERSNSSKS--GDFEHFKECIRSTKTYHLFLKHTNTNVEY 343 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 25.8 bits (54), Expect = 5.8 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = +3 Query: 291 MRRHVRSVSSFLISE*NNQTDECPGSFSRLRHSVRSV--RDFEILFVKTNY 437 M + R++ E N D+C G+F RL H + + R F + Y Sbjct: 934 MMNYSRALKLLYRVEQPNLLDDCDGNFERLEHQLEQMAYRKFRLCISMQRY 984 >SPAC1B3.02c |||transcription elongation factor, Elf1 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 107 Score = 25.4 bits (53), Expect = 7.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 106 SPQCIYVKLLTGQDIYERWIDTSD 35 S QC+ L D+Y WID D Sbjct: 55 SHQCLITALSAPIDVYSDWIDACD 78 >SPAC977.10 |sod2||CPA1 sodium ion/proton antiporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 468 Score = 25.4 bits (53), Expect = 7.7 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +1 Query: 295 DGMFVRLVHF*FQNETIKRTNALVRSVVYVILYVPCAILKFYSLKRIIIFHMVFLFKH 468 DGM V +F + T+K + R V +++ CA F+ +I + + F+ KH Sbjct: 178 DGMAVPFFYFAIKLLTVKPSRNAGRDWVLLVVLYECAFGIFFGC--VIGYLLSFILKH 233 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,379,293 Number of Sequences: 5004 Number of extensions: 41861 Number of successful extensions: 75 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -