BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30443 (446 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.76 SB_30174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_47685| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_33563| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_28522| Best HMM Match : cNMP_binding (HMM E-Value=1.1e-17) 29 2.3 SB_28399| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_26334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_20797| Best HMM Match : SoxE (HMM E-Value=0.046) 29 2.3 SB_8055| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_8890| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_4852| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) 28 3.1 SB_24014| Best HMM Match : Metallophos (HMM E-Value=8.5) 28 3.1 SB_15312| Best HMM Match : EGF (HMM E-Value=7.1e-21) 28 4.0 SB_32655| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_13924| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_45760| Best HMM Match : Drf_FH1 (HMM E-Value=3.6) 27 9.3 SB_22138| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_8425| Best HMM Match : EGF (HMM E-Value=0) 27 9.3 >SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1696 Score = 30.3 bits (65), Expect = 0.76 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 195 TTIGSTCLDCTTKQVCTKVGGIQRACLD 278 TT+GSTC D CT++G +R LD Sbjct: 39 TTLGSTCADSGITSSCTQLGQGERRSLD 66 >SB_30174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 29.5 bits (63), Expect = 1.3 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -1 Query: 284 SRVQTRPLYTSYFCTNLLGSAI*ASTTDGGARSPLRVPGSGCDP 153 +RV+ P++ +Y C N+ SAI + + AR+ VP G P Sbjct: 541 ARVKEGPVFNAYACANMYQSAIFTAKVEIRARAITDVPKEGRFP 584 >SB_47685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 195 TTIGSTCLDCTTKQVCTKVGGIQRACLD 278 T++GSTC D CT++G +R LD Sbjct: 30 TSLGSTCADSGITSSCTQLGQGERRSLD 57 >SB_33563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 195 TTIGSTCLDCTTKQVCTKVGGIQRACLD 278 T++GSTC D CT++G +R LD Sbjct: 8 TSLGSTCADSGITSSCTQLGQGERRSLD 35 >SB_28522| Best HMM Match : cNMP_binding (HMM E-Value=1.1e-17) Length = 380 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 195 TTIGSTCLDCTTKQVCTKVGGIQRACLD 278 T++GSTC D CT++G +R LD Sbjct: 8 TSLGSTCADSGITSSCTQLGQGERRSLD 35 >SB_28399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 195 TTIGSTCLDCTTKQVCTKVGGIQRACLD 278 T++GSTC D CT++G +R LD Sbjct: 8 TSLGSTCADSGITSSCTQLGQGERRSLD 35 >SB_26334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 195 TTIGSTCLDCTTKQVCTKVGGIQRACLD 278 T++GSTC D CT++G +R LD Sbjct: 8 TSLGSTCADSGITSSCTQLGQGERRSLD 35 >SB_20797| Best HMM Match : SoxE (HMM E-Value=0.046) Length = 641 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -3 Query: 372 KRSVLQMHQRPVHILQRG*RSILRGCSKEESGPDTPS 262 K + ++++ P+HI + +R CSK+ S PDT S Sbjct: 488 KETEVKLNGGPLHITHTDTVNTIRECSKDMSDPDTNS 524 >SB_8055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 195 TTIGSTCLDCTTKQVCTKVGGIQRACLD 278 T++GSTC D CT++G +R LD Sbjct: 153 TSLGSTCADSGITSSCTQLGQGERRSLD 180 >SB_8890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 195 TTIGSTCLDCTTKQVCTKVGGIQRACLD 278 T++GSTC D CT++G +R LD Sbjct: 30 TSLGSTCADSGITSSCTQLGQGERRSLD 57 >SB_4852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 195 TTIGSTCLDCTTKQVCTKVGGIQRACLD 278 T++GSTC D CT++G +R LD Sbjct: 8 TSLGSTCADSGITSSCTQLGQGERRSLD 35 >SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) Length = 896 Score = 28.3 bits (60), Expect = 3.1 Identities = 22/54 (40%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = -1 Query: 257 TSYFCTNLLGSAI*ASTTDGGARSPLRVPGSGCD-PWRYPRVDCAIVPA--SPT 105 TSY C + L S T L +P CD P RYP VD I+P SPT Sbjct: 450 TSYPCVDALAIPQCDSPTRYPCLDALTIPQ--CDSPTRYPYVDALIIPQCDSPT 501 >SB_24014| Best HMM Match : Metallophos (HMM E-Value=8.5) Length = 252 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -1 Query: 206 TDGGARSPLRVPGSGCDPW 150 T GGA+ P PG G PW Sbjct: 32 TSGGAKDPSGAPGDGFHPW 50 >SB_15312| Best HMM Match : EGF (HMM E-Value=7.1e-21) Length = 77 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 186 APCTTIGSTCLDCTTKQVCTKVGGIQRACLDPTLPYCNLGEC 311 +PC G+TC+D K CT GG + + C C Sbjct: 8 SPCQN-GATCVDGINKYTCTCAGGYTGTHCETDINECASSPC 48 >SB_32655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 474 Score = 27.1 bits (57), Expect = 7.1 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = -3 Query: 225 CNLGKYYRWWCTEPTAGTRERMRSMEVSKG*LRHCSSLPNRRHH-RWQVEGQPKLLL 58 C +G Y + C T M++M KG L+ + + H RW +EG PK++L Sbjct: 88 CMMGIYNKAQCNMEVEMTEPDMKAM---KGALKCMRNKGVQVHFGRWLIEGYPKVVL 141 >SB_13924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -1 Query: 284 SRVQTRPLYTSYFCTNLLGSAI*ASTTDGGARSPLRVPGSGCDP 153 +RV+ P++ + CTN+ SAI + + AR+ VP G P Sbjct: 201 ARVKEGPVFIACTCTNMYQSAIFTAKVEIRARAITDVPKMGRFP 244 >SB_45760| Best HMM Match : Drf_FH1 (HMM E-Value=3.6) Length = 173 Score = 26.6 bits (56), Expect = 9.3 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 8/55 (14%) Frame = +3 Query: 192 CTTIGSTCLD-CT-----TKQVCTKVGGIQRACL--DPTLPYCNLGECSATPAEG 332 CT GS+ + CT T CT +G + T+PYC SA P++G Sbjct: 113 CTFTGSSTIPYCTFTGSSTIPYCTSLGPLHYCTFTGSSTIPYCTFTGPSAVPSKG 167 >SB_22138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1047 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 361 ATDAPEAGSHPSAGVAEHSP 302 A P++G HP+AGV E+SP Sbjct: 383 ADSCPQSGKHPAAGV-EYSP 401 >SB_8425| Best HMM Match : EGF (HMM E-Value=0) Length = 1955 Score = 26.6 bits (56), Expect = 9.3 Identities = 17/59 (28%), Positives = 20/59 (33%) Frame = +3 Query: 189 PCTTIGSTCLDCTTKQVCTKVGGIQRACLDPTLPYCNLGECSATPAEGCEPASGASVAP 365 PC GSTC+D C G D C+ C +P SGA P Sbjct: 478 PCYQ-GSTCIDKVNGYECICAAGYSGPNCDVISGLCSSSRCQNGAKCVAKPPSGACECP 535 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,916,538 Number of Sequences: 59808 Number of extensions: 296813 Number of successful extensions: 907 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 896 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -