BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30442 (718 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q26F27 Cluster: Vitamin K-dependent gamma-glutamyl carb... 33 7.0 UniRef50_Q21041 Cluster: Putative uncharacterized protein ver-4;... 33 7.0 >UniRef50_Q26F27 Cluster: Vitamin K-dependent gamma-glutamyl carboxylase; n=8; Bacteroidetes|Rep: Vitamin K-dependent gamma-glutamyl carboxylase - Flavobacteria bacterium BBFL7 Length = 460 Score = 33.1 bits (72), Expect = 7.0 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -2 Query: 237 TFFSNHYETQNFLNKLLCFSVNNYHCSLKFMHTFNPLSFSPDLYKW 100 T + NHY + L+ L+ F +N + S+ + HT LS P + +W Sbjct: 108 TTYLNHYYFISILSFLMIFLPSNRYFSIDYYHTNKSLSAVPSIPRW 153 >UniRef50_Q21041 Cluster: Putative uncharacterized protein ver-4; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein ver-4 - Caenorhabditis elegans Length = 1199 Score = 33.1 bits (72), Expect = 7.0 Identities = 21/57 (36%), Positives = 31/57 (54%) Frame = -1 Query: 580 FYNNNKKKSNLT*YSGFIHTFFPSVFIILHKKASRFH*YNIKKRRTKTNSISLTSKA 410 FY N +K + T GFI+ F +L K+ F N+KK++T T I++TS A Sbjct: 521 FYKNKLRKIDDTFEKGFIYNF------VLAKRTD-FKCINVKKKKTSTKFITVTSNA 570 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 688,940,610 Number of Sequences: 1657284 Number of extensions: 12819664 Number of successful extensions: 26151 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26146 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 57851245060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -