BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30440 (748 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 26 0.33 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 3.0 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 3.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.3 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.3 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.3 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.3 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 9.3 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 9.3 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 26.2 bits (55), Expect = 0.33 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = +1 Query: 619 DAPRKPRDLLKMEANSLRFHHQSIRLMDNADQTVKDILAVLKV 747 +A ++ +D + SLRF++ +L+DN + + DIL + V Sbjct: 540 NATKQIKDEANKKGVSLRFYNVVYKLIDNIKKEIYDILPEVDV 582 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 609 PNRRCSKEAKGLIENGSEQFEISSSE 686 PNRR + + IE+G + SSE Sbjct: 391 PNRRARGQLRTKIESGEGTIPVKSSE 416 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +1 Query: 469 YTHGKHEVYSFRETSTCEYEIIILSPFLCEHP 564 Y HG+ + R+T T ++++ F+C P Sbjct: 244 YVHGETKQVQSRKTITRMLSAVVITFFICWAP 275 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 175 RLESYWSYEVCHGRYIRQYHEER 243 R S+ CH RY HE+R Sbjct: 220 RSRSFQRTSSCHSRYEDSRHEDR 242 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 175 RLESYWSYEVCHGRYIRQYHEER 243 R S+ CH RY HE+R Sbjct: 220 RSRSFQRTSSCHSRYEDSRHEDR 242 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 175 RLESYWSYEVCHGRYIRQYHEER 243 R S+ CH RY HE+R Sbjct: 220 RSRSFQRTSSCHSRYEDSRHEDR 242 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 175 RLESYWSYEVCHGRYIRQYHEER 243 R S+ CH RY HE+R Sbjct: 220 RSRSFQRTSSCHSRYEDSRHEDR 242 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 175 RLESYWSYEVCHGRYIRQYHEER 243 R S+ CH RY HE+R Sbjct: 220 RSRSFQRTSSCHSRYEDSRHEDR 242 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 175 RLESYWSYEVCHGRYIRQYHEER 243 R S+ CH RY HE+R Sbjct: 220 RSRSFQRTSSCHSRYEDSRHEDR 242 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 175 RLESYWSYEVCHGRYIRQYHEER 243 R S+ CH RY HE+R Sbjct: 220 RSRSFQRTSSCHSRYEDLRHEDR 242 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.4 bits (43), Expect = 9.3 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = -1 Query: 427 NHKLYHHPLLFQR 389 +H L+HH +L+Q+ Sbjct: 73 HHHLHHHQVLYQQ 85 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.316 0.133 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,183 Number of Sequences: 438 Number of extensions: 4819 Number of successful extensions: 20 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -