BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30438 (540 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0800 - 6221306-6223016,6223418-6223443,6223653-6223664 30 1.0 07_01_1005 + 8509777-8509968,8510059-8510205,8510326-8510544,851... 29 1.8 11_08_0100 + 28348518-28348640,28349294-28349371,28349837-283499... 27 9.6 06_01_0429 - 3056302-3056570,3056681-3056951,3057055-3057206,305... 27 9.6 01_06_1749 - 39636951-39638102 27 9.6 01_01_0635 - 4795434-4795461,4795897-4797365 27 9.6 01_01_0372 - 2900602-2900742,2900817-2901086,2901108-2901197,290... 27 9.6 >01_01_0800 - 6221306-6223016,6223418-6223443,6223653-6223664 Length = 582 Score = 30.3 bits (65), Expect = 1.0 Identities = 20/53 (37%), Positives = 26/53 (49%) Frame = -2 Query: 413 SSKVSV*LQQLPHPSNRNALLLHGRNKQGGGTYPCGLTRRPTTSNYANYSFAG 255 S ++ + LQ LP P + HG GGG G T++ S ANYSF G Sbjct: 388 SQELRLSLQSLPDPMFHHQQHRHG----GGGGGGNGTTQQALFSGAANYSFGG 436 >07_01_1005 + 8509777-8509968,8510059-8510205,8510326-8510544, 8510652-8510761,8511337-8511391,8511447-8511631, 8512537-8512599,8513713-8513782,8514159-8514242, 8515925-8516159,8516213-8516517 Length = 554 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = -2 Query: 284 SNYANYSFAGFILLVKFEVNRKQITK*VINIREVFY 177 ++Y + F GF+ +VKF + KQ+T+ V N+ ++ + Sbjct: 242 ASYGMWGFPGFLSIVKF-LRSKQVTRKVTNVIQLLF 276 >11_08_0100 + 28348518-28348640,28349294-28349371,28349837-28349977, 28350040-28350116,28350221-28350370,28350467-28350680 Length = 260 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -3 Query: 442 RKCAIHLEI*ALRSQYSYNSCPTLQTETHYCSTAEISRVVVPT 314 RK A HL+ + +++ + SCP L ET ST+ + +V T Sbjct: 107 RKIADHLKSLSEKTRVIFLSCPPLNEETLRKSTSTVLSEIVRT 149 >06_01_0429 - 3056302-3056570,3056681-3056951,3057055-3057206, 3057419-3057631,3057791-3057959 Length = 357 Score = 27.1 bits (57), Expect = 9.6 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = -2 Query: 416 ISSKVSV*LQQLPHPSNRNALLLHGRNKQGGGTYPCGLTRRPTTSN 279 + SK+S +Q+L + RN ++ N G YP LT+ P TSN Sbjct: 169 VVSKISSTVQELYNIGARNIMVF---NMAPIGCYPAFLTKLPHTSN 211 >01_06_1749 - 39636951-39638102 Length = 383 Score = 27.1 bits (57), Expect = 9.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 399 SIVTTAAPPFKPKRITA 349 S+ + AAPPF P RIT+ Sbjct: 165 SVASAAAPPFDPSRITS 181 >01_01_0635 - 4795434-4795461,4795897-4797365 Length = 498 Score = 27.1 bits (57), Expect = 9.6 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = -1 Query: 474 K*LLESTDIYNVNAPSTLRYKL*GLSIVTTAAPPFKPKRITAPRQK 337 K LL+ T N +PST R GLS +++ P + ++ T RQ+ Sbjct: 448 KVLLDCTGYSNKGSPSTARRMSEGLSFISSEMPSYLSRK-TIKRQE 492 >01_01_0372 - 2900602-2900742,2900817-2901086,2901108-2901197, 2902557-2902619 Length = 187 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 322 PPPCLFLPWSSNAFRFEGWGSCCNYTETL 408 PPP + +A RF G CCNY TL Sbjct: 27 PPPASTELYRGSASRF---GDCCNYVSTL 52 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,851,870 Number of Sequences: 37544 Number of extensions: 296035 Number of successful extensions: 577 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1198356516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -