BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30438 (540 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36000| Best HMM Match : DUF1379 (HMM E-Value=4.8) 28 4.2 SB_28540| Best HMM Match : Stig1 (HMM E-Value=2.6) 27 9.8 SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 >SB_36000| Best HMM Match : DUF1379 (HMM E-Value=4.8) Length = 420 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = +1 Query: 325 PPCLFLPWSSNAFRFEGWGSCCNYTETLELISQGGWRIYVV 447 P CL WS RF C T + GW++ +V Sbjct: 147 PTCLATDWSKTGIRFWLLQKHCKCPSTAPFCCRSGWKVTLV 187 >SB_28540| Best HMM Match : Stig1 (HMM E-Value=2.6) Length = 465 Score = 27.1 bits (57), Expect = 9.8 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +1 Query: 376 WGSCCNYTETLELISQGGWRIYVVD 450 WGS C +++ + + + GG+ +Y +D Sbjct: 127 WGSICQWSQMIRVKNCGGFYVYELD 151 >SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2162 Score = 27.1 bits (57), Expect = 9.8 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -3 Query: 100 KISYTSFEVLKITEFGNT--SNTIGYYVPNPCIS 5 ++SY +E +GN S + Y PNPCI+ Sbjct: 1951 RLSYNKYECNCTEGYGNMNCSGLLSYCTPNPCIN 1984 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,955,122 Number of Sequences: 59808 Number of extensions: 332504 Number of successful extensions: 784 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -