BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30437 (745 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.16 |||mitochondrial inner membrane protein involved in ... 40 5e-04 SPBC14F5.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 25 8.6 >SPBC16A3.16 |||mitochondrial inner membrane protein involved in cytochrome c oxidase assembly Pet191 |Schizosaccharomyces pombe|chr 2|||Manual Length = 85 Score = 39.5 bits (88), Expect = 5e-04 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +3 Query: 186 RECLK-VGLVPEECLQLRQSFFECKRSLLDNRRRFR 290 RECLK +PEEC L +++ ECKR +LD +R+R Sbjct: 30 RECLKNKDELPEECKNLIEAYGECKRQMLDMTKRYR 65 >SPBC14F5.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 515 Score = 25.4 bits (53), Expect = 8.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 144 NMTLNLHVYRHMATDLLSLSRQEQN 70 N L +HVY+H+ DL S ++N Sbjct: 128 NHKLEIHVYKHILPDLPQSSEVDRN 152 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,774,195 Number of Sequences: 5004 Number of extensions: 54381 Number of successful extensions: 128 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -