BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30437 (745 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0404 - 23153454-23154305,23154335-23155627 29 5.2 09_04_0756 + 19957247-19957315,19957426-19957584 29 5.2 >11_06_0404 - 23153454-23154305,23154335-23155627 Length = 714 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = -2 Query: 330 KLFKIIYLNILYDLETFFYCLVKIVYTQRSFVSIVSILQALSQL 199 ++F+I+ L I + L+ +FY L IV+ Q +S+LQ+L+ L Sbjct: 107 RVFRIMELEISF-LKDYFYTLYPIVFWQGLASLSLSVLQSLAAL 149 >09_04_0756 + 19957247-19957315,19957426-19957584 Length = 75 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = +3 Query: 186 RECL--KVGLVPEECLQLRQSFFECKR 260 +EC KV + EC+ LR+++F CKR Sbjct: 30 KECAGEKVPNITSECVGLRETYFNCKR 56 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,286,582 Number of Sequences: 37544 Number of extensions: 266684 Number of successful extensions: 404 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1968901276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -