BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30437 (745 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL034393-12|CAA22316.1| 96|Caenorhabditis elegans Hypothetical... 48 9e-06 Z74039-1|CAA98503.1| 451|Caenorhabditis elegans Hypothetical pr... 28 8.0 >AL034393-12|CAA22316.1| 96|Caenorhabditis elegans Hypothetical protein Y18D10A.16 protein. Length = 96 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 3/42 (7%) Frame = +3 Query: 186 RECLKV---GLVPEECLQLRQSFFECKRSLLDNRRRFRGHKG 302 +EC+ G VP++C + Q+F +CKRSL+D R RFRG KG Sbjct: 53 KECIDARGDGSVPDKCFAVLQNFTDCKRSLVDMRSRFRGRKG 94 >Z74039-1|CAA98503.1| 451|Caenorhabditis elegans Hypothetical protein K03B8.1 protein. Length = 451 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -1 Query: 739 RTYYKPMSQSNKLQS*NLLVQLTSETIQ*KCMKIPWNFILP*ILITF 599 + +Y +KLQ L ++ S+T++ K MK NFI +TF Sbjct: 84 KVFYCNADSFSKLQLKKLKLKKNSDTVKRKLMKFAMNFISSQTCVTF 130 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,832,695 Number of Sequences: 27780 Number of extensions: 286869 Number of successful extensions: 667 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -