BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30437 (745 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 0.75 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 4.0 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 23 4.0 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 4.0 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 9.2 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 25.0 bits (52), Expect = 0.75 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 171 PFCNNHFLINMTLNLHVYRHMATDL 97 PF + HF+ + NLHVY + L Sbjct: 985 PFEHRHFISGIDSNLHVYAPLKISL 1009 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 387 HYFVFKSSIGNES*TKHLIK 328 HY KSS+ N S KH +K Sbjct: 576 HYLDAKSSVQNYSLAKHQLK 595 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 195 LKVGLVPEECLQLRQSFFECKRS 263 L VG+V C + Q+F+E R+ Sbjct: 410 LAVGIVGGACSDVEQNFYEVARN 432 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -1 Query: 256 LHSKKLCLNCKHSSGTKPTFKHSLGVFLSF 167 LH + +C CK + T ++ L +F + Sbjct: 19 LHGQVICFVCKDITSTSALYRLKLYLFCDY 48 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 9.2 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 228 QLRQSFFECKRSLLDNRRR 284 ++++ + E R+ +DNRRR Sbjct: 499 KIQEIYLEALRAYVDNRRR 517 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,718 Number of Sequences: 438 Number of extensions: 3668 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -