BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30436 (736 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1E7.08c |||membrane transporter|Schizosaccharomyces pombe|c... 30 0.30 SPCC188.09c |||glycoprotein |Schizosaccharomyces pombe|chr 3|||M... 28 1.6 SPAC18G6.09c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 27 2.1 SPBC119.07 |ppk19||serine/threonine protein kinase Ppk19|Schizos... 27 2.1 SPAC19A8.05c |vps27|sst4|sorting receptor for ubiquitinated memb... 26 4.8 >SPAPB1E7.08c |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 554 Score = 30.3 bits (65), Expect = 0.30 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%) Frame = +2 Query: 506 AIELTGYGRFHYMLLAVCGLVSTSEEMDVISMSFILPSAQCDLDLTTQTKG---WLNSII 676 A+ G+GR+ + L V G S+ + + S IL +G +L Sbjct: 68 AMNEIGFGRYQWYLFFVAGFGWMSDNIWPVCTSLILMRLDEVDGPHPPAEGRAPYLTLSQ 127 Query: 677 FIGMMVGAYAWGSVADSLGR 736 +G++VGA W AD++GR Sbjct: 128 NLGLLVGAMVWSLSADTIGR 147 >SPCC188.09c |||glycoprotein |Schizosaccharomyces pombe|chr 3|||Manual Length = 609 Score = 27.9 bits (59), Expect = 1.6 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 57 SGGTLTNNKEEAHQIVTGKLYAVGSATTPSERRLSVPA-TTIQS 185 +GGT+TN E Q +T L A S T P + +P +TI S Sbjct: 324 TGGTVTNTVYEGSQTITSTL-ATASGTVPGTVEVILPGPSTIYS 366 >SPAC18G6.09c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 312 Score = 27.5 bits (58), Expect = 2.1 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -2 Query: 498 KSAFSELEPFSGSDFDFLTEGTTPSSAVLEPGPFSCRSPFTSQL 367 KS S + SG+D F + ++ ++++L GP SP S L Sbjct: 129 KSVSSYVSNSSGADRSFSSNSSSDTNSILYAGPTFTHSPAASNL 172 >SPBC119.07 |ppk19||serine/threonine protein kinase Ppk19|Schizosaccharomyces pombe|chr 2|||Manual Length = 1706 Score = 27.5 bits (58), Expect = 2.1 Identities = 20/93 (21%), Positives = 42/93 (45%), Gaps = 1/93 (1%) Frame = +2 Query: 389 LQLNGPGSKTAELGVVPSVKKSKSDPEKGSNSEKADFERAIELTGYGRFHYMLLAVCGLV 568 L +N G +P++ S S +++ R + +T + R Y+ + + ++ Sbjct: 1302 LDVNNQRHTLISAGRIPNLDFSDSVTSMEASTFHDGSIRLVVVTKWSRIVYLDVGMMRVL 1361 Query: 569 STSE-EMDVISMSFILPSAQCDLDLTTQTKGWL 664 S+ + + S + ++ S C+ L TKGWL Sbjct: 1362 SSDQLPLQCGSATSVVVSEGCNWALIGTTKGWL 1394 >SPAC19A8.05c |vps27|sst4|sorting receptor for ubiquitinated membrane proteins, ESCRT 0 complex|Schizosaccharomyces pombe|chr 1|||Manual Length = 610 Score = 26.2 bits (55), Expect = 4.8 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +2 Query: 371 CDVKGDLQLNGPGSKTAELGVVPSVKKSKSDPEKG-SNSEKADFERAIELT 520 CD L+ GSK+ K++ P K +N+E D +RAIEL+ Sbjct: 222 CDSCYSLRTKPKGSKSRARNERKFHAKTRKTPSKPVTNNEDEDIKRAIELS 272 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,227,104 Number of Sequences: 5004 Number of extensions: 69607 Number of successful extensions: 185 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 185 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -