BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30433 (711 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 28 0.10 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 5.0 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 6.6 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 8.7 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 8.7 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 27.9 bits (59), Expect = 0.10 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +2 Query: 62 TKSEINDTPIPFSLTNNSLPAGKSTLNSTSVGQSTLDQLSSDYPDDLKQVNNVGSGLKNM 241 T S I P + T P TL Q TL +++S+Y ++ + +NN ++ Sbjct: 445 TSSHILQQPSIRTYTQQQFPYVHDTLQIQPQEQLTLSKVTSNYHEEFQSLNNAVGEMEAT 504 Query: 242 N 244 N Sbjct: 505 N 505 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/58 (20%), Positives = 32/58 (55%), Gaps = 5/58 (8%) Frame = +2 Query: 113 SLPAGKSTLNSTSVGQSTLDQLSSDYPDD--LKQVNNVGS---GLKNMNSEAVIQESQ 271 SLPA +++NS +V + ++ + + + K+ N+G + ++++++Q +Q Sbjct: 858 SLPASSTSINSITVEKDVINDVKTQITTNTPAKKATNIGGKPVAVVKSSAQSLLQSNQ 915 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 438 HHRHQV*KSSHLGYR 482 HH HQ HL YR Sbjct: 353 HHHHQTQSLQHLHYR 367 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 491 TVRDSEINGKILEVAKNDPAAE 556 T+R +E++ + E A+N AAE Sbjct: 1121 TLRTAEVHNRSRETARNRMAAE 1142 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 8.7 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +2 Query: 476 LPLVGTVRDSEINGKILEVAKNDPAAEISNRKNSKDGTPTLKIF 607 L L+G D++ + + ++ DP R KDG T+ F Sbjct: 22 LLLLGRTVDAQRSLEFFDLLPEDPKLYDKMRPPKKDGQATVVYF 65 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 632 LYSEPTVSYSKSEDLTFSHYTV 697 L + PT +YS S L+ + Y++ Sbjct: 181 LVANPTANYSASTTLSHAEYSM 202 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,598 Number of Sequences: 438 Number of extensions: 4013 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -