BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30432 (405 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15178| Best HMM Match : Carn_acyltransf (HMM E-Value=1.5) 29 1.4 SB_59727| Best HMM Match : C2 (HMM E-Value=0.0018) 27 4.4 >SB_15178| Best HMM Match : Carn_acyltransf (HMM E-Value=1.5) Length = 333 Score = 29.1 bits (62), Expect = 1.4 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = -2 Query: 245 DEDGDRCLWYLKAPLMDRFGSYLMNHISKSMEKILLSYTDYPLLLR 108 D RCLWY A DRFG +S E + Y ++LR Sbjct: 4 DTKQGRCLWYCPASCDDRFGLRPEEPYLQSAELPSQAQVSYSIILR 49 >SB_59727| Best HMM Match : C2 (HMM E-Value=0.0018) Length = 482 Score = 27.5 bits (58), Expect = 4.4 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 7/68 (10%) Frame = +3 Query: 219 PQAPVTVLVEPVACDEGLDEPI--HPQTQPTEFL---AGSSQCGRD-YDPMEHSAKNCS- 377 PQAP + +A EP+ H + T + G+ + ++ Y+PM H+A+N S Sbjct: 73 PQAPTHIGQPLIALKSHAFEPVKAHTSIRSTAEIDEGIGTHEPQQEIYNPMHHAAQNGST 132 Query: 378 C*PVLPTP 401 C ++PTP Sbjct: 133 CTALVPTP 140 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,248,505 Number of Sequences: 59808 Number of extensions: 261623 Number of successful extensions: 786 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 786 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 727815563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -