BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30432 (405 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63920.1 68418.m08026 DNA topoisomerase III alpha, putative s... 29 1.6 At3g26700.1 68416.m03339 protein kinase family protein contains ... 27 6.3 >At5g63920.1 68418.m08026 DNA topoisomerase III alpha, putative similar to Swiss-Prot:Q9NG98 DNA topoisomerase III alpha [Drosophila melanogaster] Length = 926 Score = 28.7 bits (61), Expect = 1.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 267 GLDEPIHPQTQPTEFLAGSSQCGRDY 344 G D+ HP PT+F +G S RD+ Sbjct: 391 GHDDKAHPPIHPTKFSSGESNWSRDH 416 >At3g26700.1 68416.m03339 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 380 Score = 26.6 bits (56), Expect = 6.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 127 ITLYCLDVGTSSQPTWC*VVTGAHRHLQRK 38 +TL C+DV + +PT VVT R L ++ Sbjct: 326 LTLRCVDVSSEKRPTMSFVVTELERILDKE 355 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,215,519 Number of Sequences: 28952 Number of extensions: 181885 Number of successful extensions: 450 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 595686720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -