BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30430 (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 24 5.2 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 24 5.2 AJ970245-1|CAI96717.1| 134|Anopheles gambiae putative reverse t... 23 9.0 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +2 Query: 545 WYTSFSCYFYQVFFCFRKPNVRVYNS--KYETSVY 643 WY + + F+ + CF NV +Y+S ++ +VY Sbjct: 321 WYAAVTQVFFSLTICF--GNVMMYSSYNRFHNNVY 353 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +2 Query: 545 WYTSFSCYFYQVFFCFRKPNVRVYNS--KYETSVY 643 WY + + F+ + CF NV +Y+S ++ +VY Sbjct: 321 WYAAVTQVFFSLTICF--GNVMMYSSYNRFHNNVY 353 >AJ970245-1|CAI96717.1| 134|Anopheles gambiae putative reverse transcriptase protein. Length = 134 Score = 23.0 bits (47), Expect = 9.0 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 74 SLQTVCQLQEYQRDTRVQGVVYRYKGAAVLWSNKRFDSVW 193 SL T QL + + G A+L + K FDS+W Sbjct: 43 SLSTTHQLHRVTNNIVHNRCNRKSTGLALLDTEKAFDSIW 82 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,108 Number of Sequences: 2352 Number of extensions: 12655 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -