BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30429 (757 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 25 3.3 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 24 4.4 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 24 4.4 AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. 24 5.8 Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like pr... 23 7.7 Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. 23 7.7 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 24.6 bits (51), Expect = 3.3 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +1 Query: 484 DREYYNDIKKSLDDLPDLKTEAYICNEDDLLEDFINGHSNDIDSFRIPEGNP 639 D Y ND+K DD+ DL +A I + + + + +DI RI + P Sbjct: 211 DCVYENDLKDCSDDMIDLVPQAVIPHPE--YDSESSNQQHDIALIRIEQTPP 260 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 659 YPQVDPLDYLKLYSYRIGGIVAHLPTS 739 YP P+ +YS+R+ GI+A L T+ Sbjct: 116 YPLTSPIVSSGIYSFRV-GIIADLDTN 141 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 24.2 bits (50), Expect = 4.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 151 AKERDRLILAEIAFHCLKKRPNATNMINGSTGESFTNEQIL 273 A+ R LI A + PNA + S+ ++F+NE +L Sbjct: 656 AEMRTVLIFAPSSNQSSSSTPNAEQSPSASSKDTFSNEYVL 696 >AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. Length = 187 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 652 LLLPTSGSTGLPKAVLLPNRGNSCSS 729 LL PTS S P + L + G +C S Sbjct: 16 LLNPTSYSCACPIGIQLKDNGKTCKS 41 >Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like protease ANCHYM1 protein. Length = 259 Score = 23.4 bits (48), Expect = 7.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 617 LGFPKGIQRIQYYY 658 LG+P G R+ YY+ Sbjct: 234 LGYPDGFARVSYYH 247 >Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. Length = 259 Score = 23.4 bits (48), Expect = 7.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 617 LGFPKGIQRIQYYY 658 LG+P G R+ YY+ Sbjct: 234 LGYPDGFARVSYYH 247 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 816,241 Number of Sequences: 2352 Number of extensions: 18129 Number of successful extensions: 40 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -