BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30427 (775 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPACUNK4.16c |||alpha,alpha-trehalose-phosphate synthase |Schizo... 28 1.3 SPAC4F8.06 |||mitochondrial ribosomal protein subunit S12|Schizo... 27 3.0 SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 26 5.2 SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pom... 26 6.9 SPCC320.10 |srp72||signal recognition particle subunit Srp72|Sch... 25 9.1 SPBC16G5.09 |||serine carboxypeptidase |Schizosaccharomyces pomb... 25 9.1 SPBC1773.06c |||alcohol dehydrogenase |Schizosaccharomyces pombe... 25 9.1 >SPACUNK4.16c |||alpha,alpha-trehalose-phosphate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 944 Score = 28.3 bits (60), Expect = 1.3 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -3 Query: 608 IPPTHKVPSEQDDVLQNSLITYNDIRKCGVRSRGQH 501 I P K PS L+NSL ND+ K SRG+H Sbjct: 94 IQPPPKTPSSDSPSLENSLSNLNDLFK----SRGRH 125 >SPAC4F8.06 |||mitochondrial ribosomal protein subunit S12|Schizosaccharomyces pombe|chr 1|||Manual Length = 146 Score = 27.1 bits (57), Expect = 3.0 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 11 HQDSWASTGSARRGRIC**LSECFRERPNSSRADVSRIRLMTDRS 145 ++ S A GS R +C + ++PNS+ V+R+RL T RS Sbjct: 39 NKQSVALEGSPFRRGVCTRVFTVKPKKPNSAVRKVARVRLSTGRS 83 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 26.2 bits (55), Expect = 5.2 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = -1 Query: 415 HDDLVLESITKHLKSASERYFDKATHYDNHCRR*LLLDSVSHRSQLPSMP 266 +D++ + ++ L+ A YF+ +N L+LD H+ S+P Sbjct: 1563 YDEIDTDQLSMDLQDALNAYFNNYVSEENRSHTVLVLDKSVHQFPWESLP 1612 >SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pombe|chr 1|||Manual Length = 986 Score = 25.8 bits (54), Expect = 6.9 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -1 Query: 508 ASIHIDILQVLQSCFRRLAVG-APWFVRNV 422 AS +D+ +L SC +RLA+ P F++++ Sbjct: 749 ASQMVDLQSILLSCIKRLAIAEQPRFIQSI 778 >SPCC320.10 |srp72||signal recognition particle subunit Srp72|Schizosaccharomyces pombe|chr 3|||Manual Length = 561 Score = 25.4 bits (53), Expect = 9.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 118 ANSSNDGSESRPTEKLNERQTGPKPTP 198 ANSSN ++R K + PK TP Sbjct: 507 ANSSNSSKKTRKRRKPTPKSFNPKATP 533 >SPBC16G5.09 |||serine carboxypeptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 510 Score = 25.4 bits (53), Expect = 9.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 645 TYQAKGLDWPKRLSGV*EFL 704 TY G+DWP LS + EFL Sbjct: 289 TYPTCGMDWPYDLSYLTEFL 308 >SPBC1773.06c |||alcohol dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 346 Score = 25.4 bits (53), Expect = 9.1 Identities = 18/60 (30%), Positives = 28/60 (46%) Frame = -3 Query: 206 LALGVGLGPV*RSLSFSVGRDSDPSLDEFAKHLPLNY*VSLGSTQTTISKSYPSWLSPCL 27 L LG G G +L F++ ++ ++ + L + LG+T T K P W SP L Sbjct: 170 LVLGTG-GVSTFALQFALAAGANVTVTSSSDE-KLEFAKKLGATHTINYKKTPQWASPAL 227 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,179,815 Number of Sequences: 5004 Number of extensions: 63428 Number of successful extensions: 156 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 373338084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -