BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30427 (775 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016428-6|AAK71396.2| 1733|Caenorhabditis elegans Hypothetical ... 28 6.4 U58756-9|AAC48086.1| 667|Caenorhabditis elegans Hypothetical pr... 28 8.5 >AF016428-6|AAK71396.2| 1733|Caenorhabditis elegans Hypothetical protein T05C3.2 protein. Length = 1733 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 415 HDDLVLESITKHLKSASERYFDKATHYDNHCRR*LLLDSVSHRSQ 281 HD + + + KHL + + D H R L LDSVSH+ Q Sbjct: 1304 HDTVFVAGVRKHLFLWNVSTTELLRSLDAHFGRILNLDSVSHQGQ 1348 >U58756-9|AAC48086.1| 667|Caenorhabditis elegans Hypothetical protein F58F9.7 protein. Length = 667 Score = 27.9 bits (59), Expect = 8.5 Identities = 19/52 (36%), Positives = 26/52 (50%) Frame = -2 Query: 699 ILTPRSTFSANPNPWPGKSSSWESSWINPLNSAHT*SPFGTRRRVTKLAYNL 544 I TP ST S N P K SSW S+ +N + SA+ + + + AY L Sbjct: 457 IETPMSTMSFL-NQKPSKFSSWSSNPVNDVLSAYRYLTYHLLQTTSAEAYRL 507 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,689,775 Number of Sequences: 27780 Number of extensions: 359168 Number of successful extensions: 842 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1861650246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -