BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30427 (775 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-lik... 23 2.4 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 23 3.2 >AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-like protein protein. Length = 130 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 100 FKGRCFANSSNDGSESRPTEKLNERQ 177 F+G SN+ +E P EKL ER+ Sbjct: 87 FEGEMAEKISNELNEMCPLEKLKERR 112 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 23.0 bits (47), Expect = 3.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 236 Y*LCY*TSAALALGVGLGPV*RSLSFSVGRDSDPSLDEFAKHLP 105 Y L Y +A LALGV L + S++ +PSLD +P Sbjct: 143 YPLAY-VAAKLALGVRLPDIHNSVTGKTTACFEPSLDYCVVKIP 185 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,863 Number of Sequences: 438 Number of extensions: 4876 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -