BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30425 (736 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000E4A260 Cluster: PREDICTED: hypothetical protein,... 33 5.5 >UniRef50_UPI0000E4A260 Cluster: PREDICTED: hypothetical protein, partial; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein, partial - Strongylocentrotus purpuratus Length = 718 Score = 33.5 bits (73), Expect = 5.5 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 6/100 (6%) Frame = +3 Query: 384 ISKSYIG*MFNGESKLHFPIKSKTNHLHWSQLISYLIIKKKYYQ-CYCCVPWSRSRIT*L 560 ++K ++ ++ + H P+ T WS L+SY+++ K C+ C + + IT Sbjct: 452 VTKVHLWKLYRDAAPEHGPVAESTFRKLWSDLLSYVVVAKPATDLCWTC-QQNNNLITRQ 510 Query: 561 VGITFVYLHTKNST-----LLLLVHHTKSCSHQNKMQPAK 665 GI+ +Y TK T LLLL S + N Q K Sbjct: 511 FGISDIYA-TKELTEFEKDLLLLCMILSSINDSNMTQGKK 549 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,961,654 Number of Sequences: 1657284 Number of extensions: 13866015 Number of successful extensions: 28267 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 27304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28265 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 59677054775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -