BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30425 (736 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 23 2.6 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 5.9 AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 22 5.9 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 7.8 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 106 GYVLLCARLYFSFITLKKNLASLGRV 29 GY + CAR F KK L SL R+ Sbjct: 204 GYAISCARYRFMPDIKKKGLHSLPRL 229 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 501 KKYYQCYCCVPWS 539 K YQC C V W+ Sbjct: 118 KNQYQCLCGVGWT 130 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 120 YSLNKDTFYCVHVYIFH 70 Y + KDT +H+Y H Sbjct: 79 YLIPKDTITIIHIYDLH 95 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -2 Query: 708 NISLGFAFITTTTRILLAAFCFGVNKIWCG 619 N S F + T + + F VNK CG Sbjct: 640 NGSFAFTVVGAATTYITIIYQFQVNKPTCG 669 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,759 Number of Sequences: 336 Number of extensions: 4500 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -