BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30425 (736 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC013317-1|AAH13317.1| 503|Homo sapiens NMD3 homolog (S. cerevi... 30 9.9 AF132941-1|AAD27716.1| 503|Homo sapiens CGI-07 protein protein. 30 9.9 >BC013317-1|AAH13317.1| 503|Homo sapiens NMD3 homolog (S. cerevisiae) protein. Length = 503 Score = 29.9 bits (64), Expect = 9.9 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 45 AKFFFK-VINEKYKRAHSKTYPYLNYNVLNQCMEEITDRKSSIH 173 AK F+K VI + K H KT+ YL +L M + T R IH Sbjct: 149 AKDFWKAVIQVRQKTLHKKTFYYLEQLILKYGMHQNTLRIKEIH 192 >AF132941-1|AAD27716.1| 503|Homo sapiens CGI-07 protein protein. Length = 503 Score = 29.9 bits (64), Expect = 9.9 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 45 AKFFFK-VINEKYKRAHSKTYPYLNYNVLNQCMEEITDRKSSIH 173 AK F+K VI + K H KT+ YL +L M + T R IH Sbjct: 149 AKDFWKAVIQVRQKTLHKKTFYYLEQLILKYGMHQNTLRIKEIH 192 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,495,755 Number of Sequences: 237096 Number of extensions: 2225270 Number of successful extensions: 7104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7104 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8735159784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -