BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30425 (736 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-3107|AAF50836.3| 1637|Drosophila melanogaster CG1801-PA... 29 6.6 >AE014298-3107|AAF50836.3| 1637|Drosophila melanogaster CG1801-PA protein. Length = 1637 Score = 29.1 bits (62), Expect = 6.6 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 3/82 (3%) Frame = +3 Query: 81 KRAHSKTYPYLNYNVLNQCMEEITDRKSSIH*PIICSLPIIYRHTKSNK*YEIHTHKKYI 260 K+ H P +Y +NQ M+ I + ++ I + LP+IYR + +K + Sbjct: 716 KKPHVPDQPITDY--INQFMQNI-EPENEIGDSLTYRLPVIYRPRLQKLLIHLEIDRKML 772 Query: 261 IILNLALVG---STLYIHIIVS 317 I N+ +VG S +Y+ ++ S Sbjct: 773 GIENVRVVGAELSDIYMTLVTS 794 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,556,410 Number of Sequences: 53049 Number of extensions: 621782 Number of successful extensions: 1300 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1300 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3314233461 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -