BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30424 (714 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 26 1.4 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 25 3.1 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 4.1 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 24 5.4 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 23 9.5 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 23 9.5 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 140 PLTESTSNAAICLAPS 93 PLT+ SNAA+C+ P+ Sbjct: 155 PLTDEYSNAAVCIDPA 170 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 24.6 bits (51), Expect = 3.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 160 VRLQGFAR*LNPHLMLRYAWRLP 92 VRL + + N +L+YAW LP Sbjct: 172 VRLDNYFQPANVEELLKYAWALP 194 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +1 Query: 106 HIAALDVDSVNGQILEDELNNNYKGNKVKFYKCDVTSNDLETVYDN 243 HI L V + + LE+E +K K+ + ++D+E +Y N Sbjct: 198 HIFGLHVANYM-RTLEEEDEEAFKRQFSKYISLGIKADDIENIYKN 242 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -1 Query: 447 E*SNDRRNINYCSPFAAVVFAHQIVGFERACYQSSHINSYL 325 E +ND + + + A V+ +I+GFER ++ S N +L Sbjct: 155 EAANDGKPLGFV---AGVISRERIIGFERMLWRVSRGNIFL 192 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 109 IAALDVDSVNGQILEDELNNNYKGNK 186 +AAL V S Q ED L +Y G + Sbjct: 12 LAALLVSSTTAQHAEDALKQSYDGTE 37 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 23.0 bits (47), Expect = 9.5 Identities = 6/21 (28%), Positives = 13/21 (61%) Frame = -3 Query: 115 LRYAWRLPSVSLRLPQHRCLR 53 +R W + V +++P+ RC + Sbjct: 400 IRIGWSICPVKIQIPKRRCFK 420 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 732,797 Number of Sequences: 2352 Number of extensions: 14970 Number of successful extensions: 284 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 284 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -