BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30423 (711 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0876 - 29005543-29005630,29005841-29006596,29006939-29006955 29 3.6 10_02_0139 + 5753426-5754841,5755566-5755655,5756011-5756379,575... 28 8.4 04_01_0541 - 6998030-6998521,7000666-7000732,7001057-7001202 28 8.4 >04_04_0876 - 29005543-29005630,29005841-29006596,29006939-29006955 Length = 286 Score = 29.1 bits (62), Expect = 3.6 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Frame = -3 Query: 619 HRHLQRKCATHLEIQVLRSHYSYNGCPA--LQTETHYCFTAEIGRAVVPPVPTHNSQEVL 446 HR + HL ++ R ++ G P+ L+T H ++V P P+H S L Sbjct: 19 HRVTHQTIENHLTHEI-RRQCTHAGSPSTRLRTRGHRPKVTHASKSVAAPFPSHASLRNL 77 Query: 445 PPVIISNNSVP 413 P+I + S P Sbjct: 78 HPLIAAYPSRP 88 >10_02_0139 + 5753426-5754841,5755566-5755655,5756011-5756379, 5756796-5756982,5757567-5757631 Length = 708 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 415 PELNISGKSRSRRVKEPHKAPEP 347 P N+ G VKEPH+AP P Sbjct: 344 PNTNVHGMFSMMSVKEPHQAPMP 366 >04_01_0541 - 6998030-6998521,7000666-7000732,7001057-7001202 Length = 234 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -2 Query: 536 PSNRNALLFHGRNRQGGGTSRADSQLTRGPT 444 P R+ HGR GG SR +Q RG T Sbjct: 109 PPERSPAKPHGRKEGSGGASRQPAQAARGVT 139 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,829,745 Number of Sequences: 37544 Number of extensions: 423674 Number of successful extensions: 921 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 920 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -