BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30423 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15756| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_1015| Best HMM Match : Extensin_2 (HMM E-Value=0.11) 29 2.8 SB_1271| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 >SB_15756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +2 Query: 254 AKNCSFLGEFFSRLLGEEIEWYSSRSVISNLRLGSLMRLFNST 382 A N LG+ +LG ++ +SS+ V RLG L+R++ ST Sbjct: 199 ATNAQLLGDMDGFILGSKVAEWSSKGV----RLGQLLRMYYST 237 >SB_1015| Best HMM Match : Extensin_2 (HMM E-Value=0.11) Length = 828 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = -3 Query: 481 PPV---PTHNSQEVLPPVIISNNSVPELN-ISGKSRSRRVKEPHKAPEPQVA 338 PPV P + L V IS+ PE N ++ K + + +P KAPEP++A Sbjct: 504 PPVSISPAEPKVKFLDSVKISSYKPPEPNPVAPKEPPKPILKPTKAPEPKLA 555 >SB_1271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 28.3 bits (60), Expect = 6.5 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Frame = +2 Query: 278 EFFSRLLGEEIEWYSSRSVISNLR----LGSLMRLFNSTATALPRNI*FRHGIITYYYWW 445 +FFSR ++ + S + S R + S R ++STA+ + + + F H I Y +W Sbjct: 16 KFFSRFTDRKMAFSHSTYIASKTRKYRNIKSKNRQYSSTASKIRKYLYFLHTTIQIYLFW 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,180,187 Number of Sequences: 59808 Number of extensions: 464831 Number of successful extensions: 1690 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1688 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -