BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30423 (711 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82071-2|CAB04918.2| 362|Caenorhabditis elegans Hypothetical pr... 31 1.1 Z81091-5|CAB03142.1| 768|Caenorhabditis elegans Hypothetical pr... 29 4.3 AL117193-1|CAB54981.1| 767|Caenorhabditis elegans Hypothetical ... 28 5.7 >Z82071-2|CAB04918.2| 362|Caenorhabditis elegans Hypothetical protein W05B5.2 protein. Length = 362 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 174 KNKTLPIQEVLQYALPILQYTGIIDHRQKTAHFSANSLVV 293 KN L +Q + + LP+L + + H +T HFSAN L V Sbjct: 211 KNYQL-LQTIFSFVLPLLVISILCLHMVRTLHFSANYLTV 249 >Z81091-5|CAB03142.1| 768|Caenorhabditis elegans Hypothetical protein F55H12.1 protein. Length = 768 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 657 LQSPSGVKWLLEPIDIYNVNAPPTLRYKF*GLTIVTTAAPP 535 + +P K + P + APPT+R T+ TT APP Sbjct: 1 MPTPVSTKKTIAPSTMKTTVAPPTMRTTMAPTTMKTTVAPP 41 >AL117193-1|CAB54981.1| 767|Caenorhabditis elegans Hypothetical protein Y105C5A.1 protein. Length = 767 Score = 28.3 bits (60), Expect = 5.7 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -3 Query: 484 VPPVPTHNSQEVLPPVIISNNSVPE 410 +P VP+ ++ V+P +++ N VPE Sbjct: 73 LPEVPSSSASFVIPQIVVDNEEVPE 97 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,466,852 Number of Sequences: 27780 Number of extensions: 347417 Number of successful extensions: 805 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 804 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -