BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30422 (607 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21B10.07 |||glycosyl hydrolase family 16|Schizosaccharomyces... 29 0.40 SPAP8A3.03 |||ZIP zinc transporter 1|Schizosaccharomyces pombe|c... 28 1.2 >SPBC21B10.07 |||glycosyl hydrolase family 16|Schizosaccharomyces pombe|chr 2|||Manual Length = 419 Score = 29.5 bits (63), Expect = 0.40 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 343 ARNSVGCVCGLIRSSSPSYRESFNK 417 A NS CG+ S PSY E+FNK Sbjct: 282 APNSYNAGCGVENPSGPSYGEAFNK 306 >SPAP8A3.03 |||ZIP zinc transporter 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 453 Score = 27.9 bits (59), Expect = 1.2 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 285 SCASQNLPPDRKRDPLRISGEKLSGLCLWVNSLVEPFVSRVF 410 S NLP D + + EK + C+W+NS V+ FV + F Sbjct: 91 SFLKNNLPVDTESSSEAFTIEKDNNSCVWLNS-VKSFVEKQF 131 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,250,267 Number of Sequences: 5004 Number of extensions: 40520 Number of successful extensions: 116 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -