BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30418 (702 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 23 1.8 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 7.4 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -3 Query: 577 HFRQVYPKIAVKNDGSYLFIVF*ILNIFAIVL 482 H+R + + N+ SY+ IV N++ I++ Sbjct: 148 HYRLYQLSVLIDNNMSYIIIVSFATNLYFIII 179 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -1 Query: 180 ITPSQSERTWSKESRNLLKSSTLKSNK 100 +T RTW++ +NL + +K K Sbjct: 85 VTTFYKRRTWTRLLKNLESCAKIKKTK 111 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,188 Number of Sequences: 336 Number of extensions: 3156 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -