BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30418 (702 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10593| Best HMM Match : SDF (HMM E-Value=0) 58 5e-09 SB_17428| Best HMM Match : Hydrolase (HMM E-Value=0.0047) 30 1.6 SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) 29 4.8 >SB_10593| Best HMM Match : SDF (HMM E-Value=0) Length = 629 Score = 58.4 bits (135), Expect = 5e-09 Identities = 48/168 (28%), Positives = 74/168 (44%), Gaps = 6/168 (3%) Frame = +2 Query: 197 LPRVGEFFKQMKKRGKTVNFVSNNSIRSRANYEAQFKAAGIDNGFESLIIPSIAVAEYLK 376 +P V E + ++K K V FV+NN+ ++R + +F GI + + + A Y+K Sbjct: 364 VPGVPELLQSLRKLRKKVFFVTNNNTKTREQFLEKFSKYGIQASHTEIYTSAYSTAYYIK 423 Query: 377 S-ATFNKTVYCVTCTETKRVLEAHGF-KCKEGPDLGPEYYGEYIQY----LEDDEEIGAV 538 + NK VY + L G GPD E G +QY ++ D E+G V Sbjct: 424 NIMKCNKKVYMIGGKGLSEELTQLGIPNIGYGPDCIDE--GTDVQYDDLEVDLDPEVGTV 481 Query: 539 VFDSDFRINLPKMYRAITYLKRPEVLFINGATDRSVPMKPGLLALGTG 682 D I++ K +A TY+ FI D +P G+ GTG Sbjct: 482 ACGFDQFISVKKYIKASTYIVNRGCNFIATNMDDRLPTSNGITMPGTG 529 >SB_17428| Best HMM Match : Hydrolase (HMM E-Value=0.0047) Length = 228 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +2 Query: 155 VLSDCDGVIWTQNP-LPRVGEFFKQMKKRGKTVNFVSNNSIRSRANYEAQFKAAGID 322 VL D G I +N +PR E K++++ G + FV+N + S+ + + G D Sbjct: 8 VLVDLSGTIHIENSVIPRSIEALKKLRQTGLPLRFVTNTTKESKLSLLQRLTKIGFD 64 >SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) Length = 1033 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -2 Query: 479 ALDLDLPCI*IRELLRLFW 423 ALD +P I +R+LLR+FW Sbjct: 492 ALDKQMPTIRLRQLLRIFW 510 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,656,627 Number of Sequences: 59808 Number of extensions: 391755 Number of successful extensions: 939 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -