BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30418 (702 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 25 0.92 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 22 4.9 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 4.9 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 8.6 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 24.6 bits (51), Expect = 0.92 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 397 CLLCNLY*DQKSLRSSRIQMQGR 465 CLLC DQK+L S ++ G+ Sbjct: 64 CLLCQKAFDQKNLYQSHLRSHGK 86 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -2 Query: 506 TEYIRHSTLALDLDLPCI*IRELLRLFWSQY 414 T Y S DL L + + L LFW QY Sbjct: 75 TNYYLFSLAISDLILLVLGLPNELSLFWQQY 105 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 557 RINLPKMYRAITYLKRPEVLFINGATD 637 RIN K+ R KRP F ATD Sbjct: 146 RINFTKLKRHHPRYKRPRTTFEPRATD 172 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 128 NKFLDSFDHVLSDCDGVIWTQNPLPR 205 NKF ++F +L +C G +Q PR Sbjct: 353 NKFREAFKLMLPNCCGKWSSQKSEPR 378 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,432 Number of Sequences: 438 Number of extensions: 3315 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -