BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30417 (675 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0177 + 1214226-1214294,1214707-1214794,1216095-1216308,121... 53 2e-07 07_01_0181 + 1274177-1274200,1274335-1276161,1276519-1277448,127... 50 1e-06 >02_01_0177 + 1214226-1214294,1214707-1214794,1216095-1216308, 1216413-1216738,1216860-1217013,1217377-1217438, 1218078-1218133,1219456-1221279,1221775-1222698, 1222855-1222866 Length = 1242 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -3 Query: 673 LLASLDDPSECAILHRSEPTRMQALALQLADKVGNLVDSNERIFE-KQGSFF 521 L AS D P++C I H + TR+Q L Q+ADK+ LV+SNER +E K G F Sbjct: 1095 LHASWDQPTKCIIFHNVDQTRLQGLLFQMADKLSVLVESNERAYEAKTGGTF 1146 >07_01_0181 + 1274177-1274200,1274335-1276161,1276519-1277448, 1278314-1278367 Length = 944 Score = 50.4 bits (115), Expect = 1e-06 Identities = 22/45 (48%), Positives = 31/45 (68%) Frame = -3 Query: 673 LLASLDDPSECAILHRSEPTRMQALALQLADKVGNLVDSNERIFE 539 L AS D P++C I H + TR+Q L Q++DK+ LV+SNER +E Sbjct: 781 LHASWDQPTKCIIFHNVDQTRLQGLLFQMSDKLSVLVESNERAYE 825 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,282,578 Number of Sequences: 37544 Number of extensions: 242080 Number of successful extensions: 611 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -