BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30417 (675 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 25 2.9 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 24 5.0 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 6.7 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 117 DEFYTINFITTMFTVCLV 170 D++YTI +TT F V LV Sbjct: 301 DDYYTIALLTTQFIVPLV 318 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.8 bits (49), Expect = 5.0 Identities = 15/66 (22%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Frame = -2 Query: 215 KIGLTFTLSKTLKNSH*AHCKHCSYKINCVKLVSIINSRQFLFRFQEQLISQMCIHFFIY 36 KI + L + +K+ A K+ S ++ + +S F E + + C H Y Sbjct: 357 KIASSKVLQRLIKSRGKAQAKNLSVQMVAAEKLSQCPPEMFDVILDENQLEEACNHLAEY 416 Query: 35 LK-FWK 21 L+ +W+ Sbjct: 417 LEAYWR 422 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 6.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 526 TSLVFRIYAHSNPPNFRPCRQAVVPE 603 TSL +Y HS P PCR ++P+ Sbjct: 1301 TSLSALVYQHSITPLALPCR-LIIPD 1325 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 600,035 Number of Sequences: 2352 Number of extensions: 10170 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -