BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30417 (675 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY122125-1|AAM52637.1| 910|Drosophila melanogaster GH21728p pro... 75 7e-14 AE013599-2527|AAF57818.1| 910|Drosophila melanogaster CG4954-PA... 75 7e-14 >AY122125-1|AAM52637.1| 910|Drosophila melanogaster GH21728p protein. Length = 910 Score = 75.4 bits (177), Expect = 7e-14 Identities = 35/52 (67%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -3 Query: 673 LLASLDDPSECAILHRSEPTRMQALALQLADKVGNLVDSNERIFE-KQGSFF 521 L+ASLDDPSE +HRSEP+R+QALA+Q DKV NLVD NE++F+ KQG+FF Sbjct: 797 LMASLDDPSETVGMHRSEPSRLQALAMQFVDKVTNLVDVNEKVFDMKQGNFF 848 >AE013599-2527|AAF57818.1| 910|Drosophila melanogaster CG4954-PA protein. Length = 910 Score = 75.4 bits (177), Expect = 7e-14 Identities = 35/52 (67%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -3 Query: 673 LLASLDDPSECAILHRSEPTRMQALALQLADKVGNLVDSNERIFE-KQGSFF 521 L+ASLDDPSE +HRSEP+R+QALA+Q DKV NLVD NE++F+ KQG+FF Sbjct: 797 LMASLDDPSETVGMHRSEPSRLQALAMQFVDKVTNLVDVNEKVFDMKQGNFF 848 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,481,552 Number of Sequences: 53049 Number of extensions: 428072 Number of successful extensions: 1277 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1277 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2930645700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -