BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30415 (755 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0867 + 8458570-8459168,8460128-8460313,8462684-8463167 28 9.2 01_01_0047 + 334809-334877,334966-335074,335159-335299,336337-33... 28 9.2 >08_01_0867 + 8458570-8459168,8460128-8460313,8462684-8463167 Length = 422 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 188 KSNASQNLKSAIFEGPCFGSLV-THSPEYGR 99 K N QNL + EG CFG V H EY R Sbjct: 276 KRNGLQNLYESFCEGTCFGGPVWNHILEYWR 306 >01_01_0047 + 334809-334877,334966-335074,335159-335299,336337-336498, 336577-336734,337180-337310,337385-337472,337587-337690, 338346-338444,339060-339116,339262-339337,339519-339602, 339969-340010,340128-340198,341516-341564,342370-342441, 343149-343286,343393-343473,344166-344353,344591-345188, 345274-345342,346729-346854,347048-347175,347986-348142, 348342-348388,348472-348535,348691-348765,349292-349414, 349797-349982,351179-351303,351390-351459,351974-352101, 352585-352726,353065-353163,353239-353285,353598-353652, 353758-353967,354686-354757,354836-354905,355231-355414, 355521-355644,355732-355863,356252-356317,356805-356852, 357572-357676,357728-357865,358097-358399,358482-358594, 359082-359148,359236-359310,359395-359517,359610-359618, 360156-360320,360401-360502,361545-361696,361794-361995, 362079-362126,362215-362298,362613-362657,363302-363385, 363890-363970,364044-364133,364217-364279,364824-364841, 365238-365378,365494-365550,366091-366185,366275-366383, 367067-367156,367308-367387,367480-367558,367742-367903, 368005-368136,368335-368469,368553-368618,369317-369457, 369575-369648,369685-369910 Length = 2905 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 94 YHLPYSGLCVTKLPKHGPSK-MADFRFCEALLLL 192 Y +P GLC+ GP K +A+ CE+LL L Sbjct: 1115 YFVPIFGLCIAARYGSGPEKDLAETVLCESLLQL 1148 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,603,153 Number of Sequences: 37544 Number of extensions: 368013 Number of successful extensions: 720 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -