BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30412 (709 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 25 0.53 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 25 0.93 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 25 0.93 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 25.4 bits (53), Expect = 0.53 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -1 Query: 172 CLKICFTFCGCCLS*TLFRTCRWLRGIIN*SFRF*HYLMFK*TF 41 C+ I ++C C+S F+ WL G N +F Y +F F Sbjct: 290 CVNIVTSYCKTCISGRAFQVLTWL-GYSNSAFNPIIYSIFNTEF 332 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 24.6 bits (51), Expect = 0.93 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 192 KHNYIRI*RVSLITWLHSK 248 +HNYI I +SL+TW +++ Sbjct: 2 RHNYIVILILSLLTWTYAE 20 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 24.6 bits (51), Expect = 0.93 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 192 KHNYIRI*RVSLITWLHSK 248 +HNYI I +SL+TW +++ Sbjct: 2 RHNYIVILILSLLTWTYAE 20 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,187 Number of Sequences: 438 Number of extensions: 4198 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -